Lineage for d1abwa1 (1abw A:1-142)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93559Protein Hemoglobin, alpha-chain [46486] (16 species)
  7. 93606Species Human (Homo sapiens) [TaxId:9606] [46487] (78 PDB entries)
  8. 93665Domain d1abwa1: 1abw A:1-142 [15288]
    Other proteins in same PDB: d1abwb_, d1abwd_

Details for d1abwa1

PDB Entry: 1abw (more details), 2 Å

PDB Description: deoxy rhb1.1 (recombinant hemoglobin)

SCOP Domain Sequences for d1abwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abwa1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOP Domain Coordinates for d1abwa1:

Click to download the PDB-style file with coordinates for d1abwa1.
(The format of our PDB-style files is described here.)

Timeline for d1abwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1abwa2