| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
| Protein automated matches [190064] (21 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [187205] (3 PDB entries) |
| Domain d2vb6b_: 2vb6 B: [152872] automated match to d2bbma_ complexed with adp, bef, ca, mg |
PDB Entry: 2vb6 (more details), 2.3 Å
SCOPe Domain Sequences for d2vb6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vb6b_ a.39.1.5 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emiresdidgdgqvnyeefvtmmts
Timeline for d2vb6b_: