Lineage for d2vb6b_ (2vb6 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2319893Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2320473Protein automated matches [190064] (22 species)
    not a true protein
  7. 2320489Species Chicken (Gallus gallus) [TaxId:9031] [187205] (3 PDB entries)
  8. 2320490Domain d2vb6b_: 2vb6 B: [152872]
    automated match to d2bbma_
    complexed with adp, bef, ca, mg

Details for d2vb6b_

PDB Entry: 2vb6 (more details), 2.3 Å

PDB Description: myosin vi (md-insert2-cam, delta insert1) post-rigor state (crystal form 2)
PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2vb6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vb6b_ a.39.1.5 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emiresdidgdgqvnyeefvtmmts

SCOPe Domain Coordinates for d2vb6b_:

Click to download the PDB-style file with coordinates for d2vb6b_.
(The format of our PDB-style files is described here.)

Timeline for d2vb6b_: