Lineage for d2vawa1 (2vaw A:11-208)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843636Protein Cell-division protein FtsZ [52492] (9 species)
  7. 1843681Species Pseudomonas aeruginosa [TaxId:287] [89639] (2 PDB entries)
  8. 1843684Domain d2vawa1: 2vaw A:11-208 [152856]
    Other proteins in same PDB: d2vawa2
    automatically matched to d1ofua1
    complexed with gdp

Details for d2vawa1

PDB Entry: 2vaw (more details), 2.9 Å

PDB Description: ftsz pseudomonas aeruginosa gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vawa1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg
aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva
vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl
agavrgisdiikrpgmin

SCOPe Domain Coordinates for d2vawa1:

Click to download the PDB-style file with coordinates for d2vawa1.
(The format of our PDB-style files is described here.)

Timeline for d2vawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vawa2