![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (9 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [89639] (2 PDB entries) |
![]() | Domain d2vawa1: 2vaw A:11-208 [152856] Other proteins in same PDB: d2vawa2 automatically matched to d1ofua1 complexed with gdp |
PDB Entry: 2vaw (more details), 2.9 Å
SCOPe Domain Sequences for d2vawa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vawa1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} tavikvigvgggggnavnhmaknnvegveficantdaqalkniaartvlqlgpgvtkglg aganpevgrqaaledrerisevlegadmvfittgmgggtgtgaapiiaevakemgiltva vvtrpfpfegrkrmqiadegiralaesvdslitipneklltilgkdasllaafakaddvl agavrgisdiikrpgmin
Timeline for d2vawa1: