Lineage for d2vavk_ (2vav K:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136028Family c.69.1.40: O-acetyltransferase [159756] (2 protein domains)
  6. 2136029Protein Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG [159757] (1 species)
  7. 2136030Species Acremonium chrysogenum [TaxId:5044] [159758] (3 PDB entries)
    Uniprot P39058 66-441
  8. 2136053Domain d2vavk_: 2vav K: [152854]
    automated match to d2vata1
    complexed with act, csc

Details for d2vavk_

PDB Entry: 2vav (more details), 2.5 Å

PDB Description: crystal structure of deacetylcephalosporin c acetyltransferase (dac-soak)
PDB Compounds: (K:) acetyl-coa--deacetylcephalosporin c acetyltransferase

SCOPe Domain Sequences for d2vavk_:

Sequence, based on SEQRES records: (download)

>d2vavk_ c.69.1.40 (K:) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprttirdd
vrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawf
etqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvqagrn
issqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkfdthdi
srgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneghdffv
meadkvndavrgfldqsl

Sequence, based on observed residues (ATOM records): (download)

>d2vavk_ c.69.1.40 (K:) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpygakfprttirddvrihrqv
ldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqrqci
yddpkyldgeydvddqpvrgletarkianltykskpamderfhmgqpieavssylryqaq
kfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfdehve
mgrsipnsrlcvvdtneghdffvmeadkvndavrgfldqsl

SCOPe Domain Coordinates for d2vavk_:

Click to download the PDB-style file with coordinates for d2vavk_.
(The format of our PDB-style files is described here.)

Timeline for d2vavk_: