SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vatl_ (2vat L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136028Family c.69.1.40: O-acetyltransferase [159756] (2 protein domains)
  6. 2136029Protein Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG [159757] (1 species)
  7. 2136030Species Acremonium chrysogenum [TaxId:5044] [159758] (3 PDB entries)
    Uniprot P39058 66-441
  8. 2136042Domain d2vatl_: 2vat L: [152842]
    automated match to d2vata1
    complexed with act, coa, gol

Details for d2vatl_

PDB Entry: 2vat (more details), 2.2 Å

PDB Description: crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a
PDB Compounds: (L:) acetyl-coa--deacetylcephalosporin c acetyltransferase

SCOPe Domain Sequences for d2vatl_:

Sequence, based on SEQRES records: (download)

>d2vatl_ c.69.1.40 (L:) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprttirdd
vrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawf
etqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvqagrn
issqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkfdthdi
srgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneghdffv
meadkvndavrgfldq

Sequence, based on observed residues (ATOM records): (download)

>d2vatl_ c.69.1.40 (L:) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdpygakfprttirddvrihr
qvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfetqrq
ciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmgqpieavssylryq
aqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdglysfdeh
vemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq

SCOPe Domain Coordinates for d2vatl_:

Click to download the PDB-style file with coordinates for d2vatl_.
(The format of our PDB-style files is described here.)

Timeline for d2vatl_: