Lineage for d2vata1 (2vat A:7-382)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136028Family c.69.1.40: O-acetyltransferase [159756] (2 protein domains)
  6. 2136029Protein Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG [159757] (1 species)
  7. 2136030Species Acremonium chrysogenum [TaxId:5044] [159758] (3 PDB entries)
    Uniprot P39058 66-441
  8. 2136031Domain d2vata1: 2vat A:7-382 [152831]
    complexed with act, coa, gol

Details for d2vata1

PDB Entry: 2vat (more details), 2.2 Å

PDB Description: crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a
PDB Compounds: (A:) acetyl-coa--deacetylcephalosporin c acetyltransferase

SCOPe Domain Sequences for d2vata1:

Sequence, based on SEQRES records: (download)

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaegqrpygakfprttirdd
vrihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawf
etqrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvqagrn
issqdakkeingtdsgnshragqpieavssylryqaqkfaasfdancyiamtlkfdthdi
srgragsipealamitqpaliicarsdglysfdehvemgrsipnsrlcvvdtneghdffv
meadkvndavrgfldq

Sequence, based on observed residues (ATOM records): (download)

>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}
nrfeasldaqdiarislftlesgvilrdvpvaykswgrmnvsrdncvivchtltssahvt
swwptlfgqgrafdtsryfiiclnylgspfgsagpcspdpdaerpygakfprttirddvr
ihrqvldrlgvrqiaavvgasmggmhtlewaffgpeyvrkivpiatscrqsgwcaawfet
qrqciyddpkyldgeydvddqpvrgletarkianltykskpamderfhmapgvqpieavs
sylryqaqkfaasfdancyiamtlkfdthdisrgragsipealamitqpaliicarsdgl
ysfdehvemgrsipnsrlcvvdtneghdffvmeadkvndavrgfldq

SCOPe Domain Coordinates for d2vata1:

Click to download the PDB-style file with coordinates for d2vata1.
(The format of our PDB-style files is described here.)

Timeline for d2vata1: