Lineage for d2vana2 (2van A:149-335)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563564Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2563565Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2563573Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2563815Protein automated matches [254484] (3 species)
    not a true protein
  7. 2563850Species Norway rat (Rattus norvegicus) [TaxId:10116] [255608] (2 PDB entries)
  8. 2563851Domain d2vana2: 2van A:149-335 [152827]
    Other proteins in same PDB: d2vana1
    automated match to d1zqwa2

Details for d2vana2

PDB Entry: 2van (more details), 2.1 Å

PDB Description: nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
PDB Compounds: (A:) DNA polymerse beta

SCOPe Domain Sequences for d2vana2:

Sequence, based on SEQRES records: (download)

>d2vana2 d.218.1.2 (A:149-335) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlqpkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d2vana2 d.218.1.2 (A:149-335) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpseyphrridirlqpkdqyycgvlyft
gsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdr
se

SCOPe Domain Coordinates for d2vana2:

Click to download the PDB-style file with coordinates for d2vana2.
(The format of our PDB-style files is described here.)

Timeline for d2vana2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vana1