![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
![]() | Protein automated matches [254483] (3 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [255607] (2 PDB entries) |
![]() | Domain d2vana1: 2van A:91-148 [152826] Other proteins in same PDB: d2vana2 automated match to d2vana1 |
PDB Entry: 2van (more details), 2.1 Å
SCOPe Domain Sequences for d2vana1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vana1 a.60.12.0 (A:91-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek
Timeline for d2vana1: