Lineage for d2va6a1 (2va6 A:-1-385)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 956278Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 956335Protein beta-secretase (memapsin) [50671] (1 species)
  7. 956336Species Human (Homo sapiens) [TaxId:9606] [50672] (117 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 956532Domain d2va6a1: 2va6 A:-1-385 [152822]
    automatically matched to d1fkna_
    complexed with h24, iod

Details for d2va6a1

PDB Entry: 2va6 (more details), 2.5 Å

PDB Description: x-ray crystal structure of beta secretase complexed with compound 24
PDB Compounds: (A:) beta secretase 1

SCOPe Domain Sequences for d2va6a1:

Sequence, based on SEQRES records: (download)

>d2va6a1 b.50.1.2 (A:-1-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d2va6a1 b.50.1.2 (A:-1-385) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgasvggsmiiggidhslytgslw
ytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksik
aasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpv
edvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaa
vegpfvtldmedcgyn

SCOPe Domain Coordinates for d2va6a1:

Click to download the PDB-style file with coordinates for d2va6a1.
(The format of our PDB-style files is described here.)

Timeline for d2va6a1: