Lineage for d2va2b2 (2va2 B:1-240)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884843Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (4 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 884844Protein DinB homolog (DBH) [100889] (3 species)
  7. 884850Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100890] (50 PDB entries)
  8. 884907Domain d2va2b2: 2va2 B:1-240 [152818]
    Other proteins in same PDB: d2va2a1, d2va2b1
    automatically matched to d1jx4a2
    complexed with ca, dct, dft

Details for d2va2b2

PDB Entry: 2va2 (more details), 2.8 Å

PDB Description: Complex structure of Sulfolobus solfataricus DPO4 and DNA duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand
PDB Compounds: (B:) DNA polymerase IV

SCOP Domain Sequences for d2va2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2va2b2 e.8.1.7 (B:1-240) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr

SCOP Domain Coordinates for d2va2b2:

Click to download the PDB-style file with coordinates for d2va2b2.
(The format of our PDB-style files is described here.)

Timeline for d2va2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2va2b1