Lineage for d2v9wb1 (2v9w B:241-342)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051917Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 1051918Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 1051919Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 1051920Protein DinB homolog (DBH) [100881] (3 species)
  7. 1051929Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)
  8. 1051996Domain d2v9wb1: 2v9w B:241-342 [152813]
    Other proteins in same PDB: d2v9wa2, d2v9wb2
    automatically matched to d1n48a1
    protein/DNA complex; complexed with ca, dct

Details for d2v9wb1

PDB Entry: 2v9w (more details), 3 Å

PDB Description: complex structure of sulfolobus solfataricus dpo4 and dna duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2v9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9wb1 d.240.1.1 (B:241-342) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

SCOPe Domain Coordinates for d2v9wb1:

Click to download the PDB-style file with coordinates for d2v9wb1.
(The format of our PDB-style files is described here.)

Timeline for d2v9wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9wb2