SCOP 1.75: Domain d2v9wb1: 2v9w B:241-342

Lineage for d2v9wb1 (2v9w B:241-342)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (50 PDB entries)

8. Domain d2v9wb1: 2v9w B:241-342 [152813]
   Other proteins in same PDB: d2v9wa2, d2v9wb2
   automatically matched to d1n48a1
   complexed with ca, dct, dft

Details for d2v9wb1

PDB Entry: 2v9w, 3 Å

PDB Description: complex structure of sulfolobus solfataricus dpo4 and dna duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand

PDB Compounds: (B:) DNA polymerase IV

SCOP Domain Sequences for d2v9wb1:

Sequence; same for both SEQRES and ATOM records:

>d2v9wb1 d.240.1.1 (B:241-342) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

Timeline for d2v9wb1:

• d2v9wb1 is new in SCOP 1.75
  
• d2v9wb1 appears in SCOPe 2.01
  
• d2v9wb1 appears in the current release, SCOPe 2.08