Lineage for d2v9wb1 (2v9w B:241-343)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008406Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 3008407Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 3008507Family d.240.1.0: automated matches [231323] (1 protein)
    not a true family
  6. 3008508Protein automated matches [231324] (5 species)
    not a true protein
  7. 3008530Species Sulfolobus solfataricus [TaxId:273057] [231327] (33 PDB entries)
  8. 3008563Domain d2v9wb1: 2v9w B:241-343 [152813]
    Other proteins in same PDB: d2v9wa2, d2v9wb2
    automated match to d1jx4a1
    protein/DNA complex; complexed with ca, dct

Details for d2v9wb1

PDB Entry: 2v9w (more details), 3 Å

PDB Description: complex structure of sulfolobus solfataricus dpo4 and dna duplex containing a hydrophobic thymine isostere 2,4-difluorotoluene nucleotide in the template strand
PDB Compounds: (B:) DNA polymerase IV

SCOPe Domain Sequences for d2v9wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9wb1 d.240.1.0 (B:241-343) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfiea

SCOPe Domain Coordinates for d2v9wb1:

Click to download the PDB-style file with coordinates for d2v9wb1.
(The format of our PDB-style files is described here.)

Timeline for d2v9wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9wb2