SCOP 1.75: Domain d2v9je2: 2v9j E:23-181

Lineage for d2v9je2 (2v9j E:23-181)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (1 family)

5. Family d.37.1.1: CBS-domain pair [54632] (20 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [160177] (3 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d2v9je2: 2v9j E:23-181 [152808]
   Other proteins in same PDB: d2v9ja1, d2v9jb1
   automatically matched to 2V8Q E:23-181
   complexed with amp, atp, mg

Details for d2v9je2

PDB Entry: 2v9j, 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp

PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOP Domain Sequences for d2v9je2:

Sequence; same for both SEQRES and ATOM records:

>d2v9je2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite

Timeline for d2v9je2:

• d2v9je2 is new in SCOP 1.75
  
• d2v9je2 appears in SCOPe 2.01
  
• d2v9je2 appears in the current release, SCOPe 2.08