SCOPe 2.08: Domain d2v9je1: 2v9j E:182-326

Lineage for d2v9je1 (2v9j E:182-326)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d2v9je1: 2v9j E:182-326 [152807]
   Other proteins in same PDB: d2v9ja_, d2v9jb_
   automated match to d2v8qe1
   complexed with amp, atp, mg

Details for d2v9je1

PDB Entry: 2v9j, 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp

PDB Compounds: (E:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d2v9je1:

Sequence; same for both SEQRES and ATOM records:

>d2v9je1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvltgg

Timeline for d2v9je1:

• d2v9je1 first appeared in SCOP 1.75
  
• d2v9je1 appears in SCOPe 2.07