SCOPe 2.08: Domain d2v9ab_: 2v9a B:

Lineage for d2v9ab_ (2v9a B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)

6. Protein automated matches [190413] (2 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [187288] (2 PDB entries)

8. Domain d2v9ab_: 2v9a B: [152804]
   automated match to d1p0za_

Details for d2v9ab_

PDB Entry: 2v9a, 2 Å

PDB Description: structure of citrate-free periplasmic domain of sensor histidine kinase cita

PDB Compounds: (B:) Sensor kinase citA

SCOPe Domain Sequences for d2v9ab_:

Sequence, based on SEQRES records:

>d2v9ab_ d.110.6.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
gqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigiv
svgyti

Sequence, based on observed residues (ATOM records):

>d2v9ab_ d.110.6.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas
gqrlyinaksyvsvrkgslgsslrgkspiqdatgkvigivsvgyti

Timeline for d2v9ab_:

• d2v9ab_ first appeared in SCOP 1.75, called d2v9ab1
  
• d2v9ab_ appears in SCOPe 2.07