![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.6: Sensory domain-like [103190] (3 families) ![]() alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
![]() | Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins) |
![]() | Protein automated matches [190413] (2 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [187288] (2 PDB entries) |
![]() | Domain d2v9aa_: 2v9a A: [152803] automated match to d1p0za_ |
PDB Entry: 2v9a (more details), 2 Å
SCOPe Domain Sequences for d2v9aa_:
Sequence, based on SEQRES records: (download)
>d2v9aa_ d.110.6.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas gqrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigiv svgytie
>d2v9aa_ d.110.6.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]} teerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdas gqrlnaksyvsvrkgslgsslrgkspiqdatgkvigivsvgytie
Timeline for d2v9aa_: