SCOPe 2.07: Domain d2v94b1: 2v94 B:1-93

Lineage for d2v94b1 (2v94 B:1-93)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein)
   Pfam PF01282

6. Protein Ribosomal protein S24e [117787] (4 species)

7. Species Pyrococcus abyssi [TaxId:29292] [159879] (1 PDB entry)
   Uniprot Q9UY20 1-93

8. Domain d2v94b1: 2v94 B:1-93 [152796]
   automatically matched to 2V94 A:1-93

Details for d2v94b1

PDB Entry: 2v94, 1.9 Å

PDB Description: crystal structure of p. abyssi rps24

PDB Compounds: (B:) 30S ribosomal protein S24e

SCOPe Domain Sequences for d2v94b1:

Sequence; same for both SEQRES and ATOM records:

>d2v94b1 d.12.1.3 (B:1-93) Ribosomal protein S24e {Pyrococcus abyssi [TaxId: 29292]}
meikitevkenkligrkeiyfeiyhpgeptpsrkdvkgklvamldlnpettviqyirsyf
gsykskgyakyyydkdrmlyiepeyilirdgii

Timeline for d2v94b1:

• d2v94b1 first appeared in SCOP 1.75
  
• d2v94b1 appears in SCOPe 2.06
  
• d2v94b1 appears in the current release, SCOPe 2.08