![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein) Pfam PF01282 |
![]() | Protein Ribosomal protein S24e [117787] (4 species) |
![]() | Species Pyrococcus abyssi [TaxId:29292] [159879] (1 PDB entry) Uniprot Q9UY20 1-93 |
![]() | Domain d2v94b1: 2v94 B:1-93 [152796] automatically matched to 2V94 A:1-93 |
PDB Entry: 2v94 (more details), 1.9 Å
SCOPe Domain Sequences for d2v94b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v94b1 d.12.1.3 (B:1-93) Ribosomal protein S24e {Pyrococcus abyssi [TaxId: 29292]} meikitevkenkligrkeiyfeiyhpgeptpsrkdvkgklvamldlnpettviqyirsyf gsykskgyakyyydkdrmlyiepeyilirdgii
Timeline for d2v94b1: