| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (1 family) ![]() |
| Family d.37.1.1: CBS-domain pair [54632] (20 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
| Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [160177] (3 PDB entries) Uniprot P80385 182-326! Uniprot P80385 23-181 |
| Domain d2v92e2: 2v92 E:23-181 [152794] Other proteins in same PDB: d2v92a1, d2v92b1 automatically matched to 2V8Q E:23-181 complexed with amp, atp |
PDB Entry: 2v92 (more details), 2.4 Å
SCOP Domain Sequences for d2v92e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v92e2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]}
snssvyttfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfv
gmltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavs
slirnkihrlpvidpesgntlyilthkrilkflklfite
Timeline for d2v92e2: