Class a: All alpha proteins [46456] (171 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (18 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (97 PDB entries) |
Domain d1c7da2: 1c7d A:143-284 [15279] Other proteins in same PDB: d1c7db_, d1c7dd_ recombinant hemoglobin rhb1.2 complexed with hem; mutant |
PDB Entry: 1c7d (more details), 1.8 Å
SCOP Domain Sequences for d1c7da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7da2 a.1.1.2 (A:143-284) Hemoglobin, alpha-chain {Human (Homo sapiens)} gvlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghg kkvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftp avhasldkflasvstvltskyr
Timeline for d1c7da2: