Lineage for d2v8xa1 (2v8x A:32-217)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569268Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2569269Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2569270Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2569271Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2569275Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)
  8. 2569291Domain d2v8xa1: 2v8x A:32-217 [152787]
    automatically matched to d1ipba_
    complexed with mgq

Details for d2v8xa1

PDB Entry: 2v8x (more details), 2.3 Å

PDB Description: crystallographic and mass spectrometric characterisation of eif4e with n7-cap derivatives
PDB Compounds: (A:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d2v8xa1:

Sequence, based on SEQRES records: (download)

>d2v8xa1 d.86.1.1 (A:32-217) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgstt
knrfvv

Sequence, based on observed residues (ATOM records): (download)

>d2v8xa1 d.86.1.1 (A:32-217) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
avvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtattknrfv
v

SCOPe Domain Coordinates for d2v8xa1:

Click to download the PDB-style file with coordinates for d2v8xa1.
(The format of our PDB-style files is described here.)

Timeline for d2v8xa1: