Lineage for d2v8we1 (2v8w E:34-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962643Family d.86.1.1: Translation initiation factor eIF4e [55419] (1 protein)
    automatically mapped to Pfam PF01652
  6. 2962644Protein Translation initiation factor eIF4e [55420] (3 species)
    messenger RNA 5' cap-binding protein
  7. 2962648Species Human (Homo sapiens) [TaxId:9606] [160542] (16 PDB entries)
  8. 2962662Domain d2v8we1: 2v8w E:34-217 [152786]
    automatically matched to d1ipba_
    complexed with mgo

Details for d2v8we1

PDB Entry: 2v8w (more details), 2.3 Å

PDB Description: crystallographic and mass spectrometric characterisation of eif4e with n7-cap derivatives
PDB Compounds: (E:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d2v8we1:

Sequence, based on SEQRES records: (download)

>d2v8we1 d.86.1.1 (E:34-217) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
yikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdysl
fkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgav
vnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgsttkn
rfvv

Sequence, based on observed residues (ATOM records): (download)

>d2v8we1 d.86.1.1 (E:34-217) Translation initiation factor eIF4e {Human (Homo sapiens) [TaxId: 9606]}
yikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdysl
fkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcgav
vnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtsttknrfvv

SCOPe Domain Coordinates for d2v8we1:

Click to download the PDB-style file with coordinates for d2v8we1.
(The format of our PDB-style files is described here.)

Timeline for d2v8we1: