Lineage for d2v8ba_ (2v8b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115242Species Tritirachium album [TaxId:37998] [187258] (13 PDB entries)
  8. 2115243Domain d2v8ba_: 2v8b A: [152780]
    automated match to d1ic6a_
    complexed with ca, se4

Details for d2v8ba_

PDB Entry: 2v8b (more details), 0.94 Å

PDB Description: SAD Structure solution of Proteinase K grown in selenate solution
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d2v8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v8ba_ c.41.1.1 (A:) automated matches {Tritirachium album [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d2v8ba_:

Click to download the PDB-style file with coordinates for d2v8ba_.
(The format of our PDB-style files is described here.)

Timeline for d2v8ba_: