Lineage for d1c7da1 (1c7d A:1-142)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902058Protein Hemoglobin, alpha-chain [46486] (22 species)
  7. 902171Species Human (Homo sapiens) [TaxId:9606] [46487] (200 PDB entries)
    Uniprot P69905 P01922 P01934 P01935
  8. 902284Domain d1c7da1: 1c7d A:1-142 [15278]
    Other proteins in same PDB: d1c7db_, d1c7dd_
    recombinant hemoglobin rhb1.2
    complexed with hem

Details for d1c7da1

PDB Entry: 1c7d (more details), 1.8 Å

PDB Description: deoxy rhb1.2 (recombinant hemoglobin)
PDB Compounds: (A:) protein (deoxyhemoglobin (alpha chain))

SCOPe Domain Sequences for d1c7da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7da1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

SCOPe Domain Coordinates for d1c7da1:

Click to download the PDB-style file with coordinates for d1c7da1.
(The format of our PDB-style files is described here.)

Timeline for d1c7da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c7da2