SCOPe 2.05: Domain d2v88b_: 2v88 B:

Lineage for d2v88b_ (2v88 B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)

8. Domain d2v88b_: 2v88 B: [152777]
   automated match to d2jwoa1
   protein/DNA complex; complexed with zn

Details for d2v88b_

PDB Entry: 2v88, 2 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide

PDB Compounds: (B:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v88b_:

Sequence; same for both SEQRES and ATOM records:

>d2v88b_ g.50.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihl
segsnkyycnehvqiara

Timeline for d2v88b_:

• d2v88b_ first appeared in SCOP 1.75, called d2v88b1
  
• d2v88b_ appears in SCOPe 2.04
  
• d2v88b_ is called d2v88b2 in SCOPe 2.06
  
• d2v88b_ appears in the current release, SCOPe 2.08, called d2v88b2