Lineage for d2v88a1 (2v88 A:414-487)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894022Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 894023Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 894046Family g.50.1.2: PHD domain [57911] (13 proteins)
  6. 894088Protein V(D)J recombination-activating protein 2, Rag2 [161224] (1 species)
  7. 894089Species Mouse (Mus musculus) [TaxId:10090] [161225] (7 PDB entries)
    Uniprot P21784 414-487
  8. 894098Domain d2v88a1: 2v88 A:414-487 [152776]
    automatically matched to 2JWO A:414-487
    complexed with 2mr, mly, zn

Details for d2v88a1

PDB Entry: 2v88 (more details), 2 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
PDB Compounds: (A:) vdj recombination-activating protein 2

SCOP Domain Sequences for d2v88a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v88a1 g.50.1.2 (A:414-487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara

SCOP Domain Coordinates for d2v88a1:

Click to download the PDB-style file with coordinates for d2v88a1.
(The format of our PDB-style files is described here.)

Timeline for d2v88a1: