Lineage for d2v88a2 (2v88 A:414-487)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037862Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 3037863Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 3037886Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 3037935Protein automated matches [190654] (2 species)
    not a true protein
  7. 3037943Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)
  8. 3037951Domain d2v88a2: 2v88 A:414-487 [152776]
    Other proteins in same PDB: d2v88a3, d2v88b3
    automated match to d2jwoa1
    protein/DNA complex; complexed with zn

Details for d2v88a2

PDB Entry: 2v88 (more details), 2 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3r2me2sk4me2 peptide
PDB Compounds: (A:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v88a2 g.50.1.2 (A:414-487) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara

SCOPe Domain Coordinates for d2v88a2:

Click to download the PDB-style file with coordinates for d2v88a2.
(The format of our PDB-style files is described here.)

Timeline for d2v88a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v88a3