Class g: Small proteins [56992] (98 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein automated matches [190654] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries) |
Domain d2v86b2: 2v86 B:414-487 [152773] Other proteins in same PDB: d2v86a3, d2v86b3 automated match to d2jwoa1 protein/DNA complex; complexed with zn |
PDB Entry: 2v86 (more details), 2.05 Å
SCOPe Domain Sequences for d2v86b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v86b2 g.50.1.2 (B:414-487) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs nkyycnehvqiara
Timeline for d2v86b2: