SCOPe 2.07: Domain d2v86b2: 2v86 B:414-487

Lineage for d2v86b2 (2v86 B:414-487)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)

8. Domain d2v86b2: 2v86 B:414-487 [152773]
   Other proteins in same PDB: d2v86a3, d2v86b3
   automated match to d2jwoa1
   protein/DNA complex; complexed with zn

Details for d2v86b2

PDB Entry: 2v86, 2.05 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3r2me2ak4me3 peptide

PDB Compounds: (B:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v86b2:

Sequence; same for both SEQRES and ATOM records:

>d2v86b2 g.50.1.2 (B:414-487) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara

Timeline for d2v86b2:

• d2v86b2 first appeared in SCOP 1.75, called d2v86b1
  
• d2v86b2 appears in SCOPe 2.06
  
• d2v86b2 appears in the current release, SCOPe 2.08