![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (13 proteins) |
![]() | Protein V(D)J recombination-activating protein 2, Rag2 [161224] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [161225] (7 PDB entries) Uniprot P21784 414-487 |
![]() | Domain d2v85a1: 2v85 A:414-487 [152770] automatically matched to 2JWO A:414-487 complexed with m3l, nmm, zn |
PDB Entry: 2v85 (more details), 2 Å
SCOP Domain Sequences for d2v85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v85a1 g.50.1.2 (A:414-487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]} gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs nkyycnehvqiara
Timeline for d2v85a1: