![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies) dimetal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) ![]() |
![]() | Family g.50.1.2: PHD domain [57911] (14 proteins) |
![]() | Protein automated matches [190654] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries) |
![]() | Domain d2v83c2: 2v83 C:414-483 [152769] Other proteins in same PDB: d2v83b3, d2v83c3 automated match to d2jwoa1 protein/DNA complex; complexed with zn |
PDB Entry: 2v83 (more details), 2.4 Å
SCOPe Domain Sequences for d2v83c2:
Sequence, based on SEQRES records: (download)
>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs nkyycnehvq
>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsnky ycnehvq
Timeline for d2v83c2: