Lineage for d2v83c2 (2v83 C:414-483)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642549Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642550Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2642573Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2642622Protein automated matches [190654] (2 species)
    not a true protein
  7. 2642630Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)
  8. 2642644Domain d2v83c2: 2v83 C:414-483 [152769]
    Other proteins in same PDB: d2v83b3, d2v83c3
    automated match to d2jwoa1
    protein/DNA complex; complexed with zn

Details for d2v83c2

PDB Entry: 2v83 (more details), 2.4 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3k4me3 peptide
PDB Compounds: (C:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v83c2:

Sequence, based on SEQRES records: (download)

>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvq

Sequence, based on observed residues (ATOM records): (download)

>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsnky
ycnehvq

SCOPe Domain Coordinates for d2v83c2:

Click to download the PDB-style file with coordinates for d2v83c2.
(The format of our PDB-style files is described here.)

Timeline for d2v83c2: