SCOPe 2.08: Domain d2v83c2: 2v83 C:414-483

Lineage for d2v83c2 (2v83 C:414-483)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)

8. Domain d2v83c2: 2v83 C:414-483 [152769]
   Other proteins in same PDB: d2v83b3, d2v83c3
   automated match to d2jwoa1
   protein/DNA complex; complexed with zn

Details for d2v83c2

PDB Entry: 2v83, 2.4 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3k4me3 peptide

PDB Compounds: (C:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v83c2:

Sequence, based on SEQRES records:

>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvq

Sequence, based on observed residues (ATOM records):

>d2v83c2 g.50.1.2 (C:414-483) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsnky
ycnehvq

Timeline for d2v83c2:

• d2v83c2 first appeared in SCOP 1.75, called d2v83c1
  
• d2v83c2 appears in SCOPe 2.07