SCOPe 2.06: Domain d2v83a_: 2v83 A:

Lineage for d2v83a_ (2v83 A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)

8. Domain d2v83a_: 2v83 A: [152767]
   Other proteins in same PDB: d2v83b3, d2v83c3
   automated match to d2jwoa1
   protein/DNA complex; complexed with zn

Details for d2v83a_

PDB Entry: 2v83, 2.4 Å

PDB Description: crystal structure of rag2-phd finger in complex with h3k4me3 peptide

PDB Compounds: (A:) vdj recombination-activating protein 2

SCOPe Domain Sequences for d2v83a_:

Sequence; same for both SEQRES and ATOM records:

>d2v83a_ g.50.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqia

Timeline for d2v83a_:

• d2v83a_ first appeared in SCOP 1.75, called d2v83a1
  
• d2v83a_ appears in SCOPe 2.05
  
• d2v83a_ appears in SCOPe 2.07
  
• d2v83a_ appears in the current release, SCOPe 2.08