Class b: All beta proteins [48724] (178 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) |
Family b.141.1.0: automated matches [227220] (1 protein) not a true family |
Protein automated matches [226959] (4 species) not a true protein |
Domain d2v7xc1: 2v7x C:193-298 [152765] Other proteins in same PDB: d2v7xa2, d2v7xb2, d2v7xc2 automated match to d1rqpa1 complexed with 5fd, met; mutant |
PDB Entry: 2v7x (more details), 1.96 Å
SCOPe Domain Sequences for d2v7xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7xc1 b.141.1.0 (C:193-298) automated matches {Streptomyces cattleya [TaxId: 29303]} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d2v7xc1:
View in 3D Domains from other chains: (mouse over for more information) d2v7xa1, d2v7xa2, d2v7xb1, d2v7xb2 |