Lineage for d2v7xc1 (2v7x C:193-298)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433624Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2433625Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2433668Family b.141.1.0: automated matches [227220] (1 protein)
    not a true family
  6. 2433669Protein automated matches [226959] (4 species)
    not a true protein
  7. Species Streptomyces cattleya [TaxId:29303] [255605] (4 PDB entries)
  8. 2433693Domain d2v7xc1: 2v7x C:193-298 [152765]
    Other proteins in same PDB: d2v7xa2, d2v7xb2, d2v7xc2
    automated match to d1rqpa1
    complexed with 5fd, met; mutant

Details for d2v7xc1

PDB Entry: 2v7x (more details), 1.96 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met
PDB Compounds: (C:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2v7xc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7xc1 b.141.1.0 (C:193-298) automated matches {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2v7xc1:

Click to download the PDB-style file with coordinates for d2v7xc1.
(The format of our PDB-style files is described here.)

Timeline for d2v7xc1: