SCOPe 2.05: Domain d2v7xa2: 2v7x A:8-192

Lineage for d2v7xa2 (2v7x A:8-192)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)

6. Protein automated matches [254631] (1 species)
   not a true protein
7. Species Streptomyces cattleya [TaxId:29303] [255604] (4 PDB entries)

8. Domain d2v7xa2: 2v7x A:8-192 [152762]
   Other proteins in same PDB: d2v7xa1, d2v7xb1, d2v7xc1
   automated match to d1rqpa2
   complexed with 5fd, met; mutant

Details for d2v7xa2

PDB Entry: 2v7x, 1.96 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158a mutant from streptomyces cattleya complexed with the products, fda and met

PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2v7xa2:

Sequence; same for both SEQRES and ATOM records:

>d2v7xa2 c.132.1.1 (A:8-192) automated matches {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfyaremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d2v7xa2:

• d2v7xa2 first appeared in SCOP 1.75
  
• d2v7xa2 appears in SCOPe 2.04
  
• d2v7xa2 appears in SCOPe 2.06
  
• d2v7xa2 appears in the current release, SCOPe 2.08