Lineage for d1c7ba_ (1c7b A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 349408Protein Hemoglobin, alpha-chain [46486] (17 species)
  7. 349462Species Human (Homo sapiens) [TaxId:9606] [46487] (114 PDB entries)
  8. 349533Domain d1c7ba_: 1c7b A: [15276]
    Other proteins in same PDB: d1c7bb_, d1c7bd_

Details for d1c7ba_

PDB Entry: 1c7b (more details), 1.8 Å

PDB Description: deoxy rhb1.0 (recombinant hemoglobin)

SCOP Domain Sequences for d1c7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ba_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1c7ba_:

Click to download the PDB-style file with coordinates for d1c7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ba_: