Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (20 species) |
Species Human (Homo sapiens) [TaxId:9606] [46487] (178 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
Domain d1a3oc_: 1a3o C: [15275] Other proteins in same PDB: d1a3ob_, d1a3od_ complexed with hem; mutant |
PDB Entry: 1a3o (more details), 1.8 Å
SCOP Domain Sequences for d1a3oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3oc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttkthfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1a3oc_: