Lineage for d2v7uc1 (2v7u C:193-298)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824820Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 2824821Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) (S)
  5. 2824864Family b.141.1.0: automated matches [227220] (1 protein)
    not a true family
  6. 2824865Protein automated matches [226959] (4 species)
    not a true protein
  7. 2824880Species Streptomyces cattleya [TaxId:29303] [255605] (4 PDB entries)
  8. 2824889Domain d2v7uc1: 2v7u C:193-298 [152747]
    Other proteins in same PDB: d2v7ua2, d2v7ub2, d2v7uc2
    automated match to d1rqpa1
    complexed with cl, sam; mutant

Details for d2v7uc1

PDB Entry: 2v7u (more details), 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosylmethionine and chloride ion
PDB Compounds: (C:) 5'-fluoro-5'-deoxy adenosine synthetase

SCOPe Domain Sequences for d2v7uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7uc1 b.141.1.0 (C:193-298) automated matches {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOPe Domain Coordinates for d2v7uc1:

Click to download the PDB-style file with coordinates for d2v7uc1.
(The format of our PDB-style files is described here.)

Timeline for d2v7uc1: