SCOPe 2.05: Domain d2v7ua1: 2v7u A:193-298

Lineage for d2v7ua1 (2v7u A:193-298)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
   barrel, closed; n=7, S=10; greek-key topology; one overside connection

4. Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families)

5. Family b.141.1.0: automated matches [227220] (1 protein)
   not a true family

6. Protein automated matches [226959] (2 species)
   not a true protein

7. Species Streptomyces cattleya [TaxId:29303] [255605] (4 PDB entries)

8. Domain d2v7ua1: 2v7u A:193-298 [152743]
   Other proteins in same PDB: d2v7ua2, d2v7ub2, d2v7uc2
   automated match to d1rqpa1
   complexed with cl, sam; mutant

Details for d2v7ua1

PDB Entry: 2v7u, 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosylmethionine and chloride ion

PDB Compounds: (A:) 5'-fluoro-5'-deoxy adenosine synthetase

SCOPe Domain Sequences for d2v7ua1:

Sequence; same for both SEQRES and ATOM records:

>d2v7ua1 b.141.1.0 (A:193-298) automated matches {Streptomyces cattleya [TaxId: 29303]}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

Timeline for d2v7ua1:

• d2v7ua1 first appeared in SCOP 1.75
  
• d2v7ua1 appears in SCOPe 2.04
  
• d2v7ua1 appears in SCOPe 2.06
  
• d2v7ua1 appears in the current release, SCOPe 2.08