| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) ![]() |
| Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins) |
| Protein automated matches [254631] (2 species) not a true protein |
| Species Streptomyces cattleya [TaxId:29303] [255604] (4 PDB entries) |
| Domain d2v7ta2: 2v7t A:8-192 [152738] Other proteins in same PDB: d2v7ta1, d2v7tb1, d2v7tc1 automated match to d1rqpa2 complexed with cl, sah; mutant |
PDB Entry: 2v7t (more details), 2.15 Å
SCOPe Domain Sequences for d2v7ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7ta2 c.132.1.1 (A:8-192) automated matches {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfygremvaipsahlaagfplsevgrpledhei
vrfnr
Timeline for d2v7ta2:
View in 3DDomains from other chains: (mouse over for more information) d2v7tb1, d2v7tb2, d2v7tc1, d2v7tc2 |