Lineage for d2v7ta2 (2v7t A:8-192)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923098Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2923099Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2923100Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (2 proteins)
  6. 2923142Protein automated matches [254631] (2 species)
    not a true protein
  7. 2923143Species Streptomyces cattleya [TaxId:29303] [255604] (4 PDB entries)
  8. 2923153Domain d2v7ta2: 2v7t A:8-192 [152738]
    Other proteins in same PDB: d2v7ta1, d2v7tb1, d2v7tc1
    automated match to d1rqpa2
    complexed with cl, sah; mutant

Details for d2v7ta2

PDB Entry: 2v7t (more details), 2.15 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase s158g mutant complexed with s-adenosyl-l-homocysteine and chloride ion
PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOPe Domain Sequences for d2v7ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7ta2 c.132.1.1 (A:8-192) automated matches {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfygremvaipsahlaagfplsevgrpledhei
vrfnr

SCOPe Domain Coordinates for d2v7ta2:

Click to download the PDB-style file with coordinates for d2v7ta2.
(The format of our PDB-style files is described here.)

Timeline for d2v7ta2: