Lineage for d2v7qj_ (2v7q J:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1710138Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 1710207Superfamily h.4.8: F1 ATPase inhibitor, IF1, C-terminal domain [64602] (1 family) (S)
  5. 1710208Family h.4.8.1: F1 ATPase inhibitor, IF1, C-terminal domain [64603] (2 proteins)
  6. 1710218Protein automated matches [254630] (1 species)
    not a true protein
  7. 1710219Species Cow (Bos taurus) [TaxId:9913] [255603] (1 PDB entry)
  8. 1710220Domain d2v7qj_: 2v7q J: [152736]
    Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_
    automated match to d1ohhh_
    complexed with adp, atp, mg, po4

Details for d2v7qj_

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (J:) ATPase inhibitor

SCOPe Domain Sequences for d2v7qj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qj_ h.4.8.1 (J:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vrssagavrdaggafgkreqaeeeryfrarakeqlaalkkhhe

SCOPe Domain Coordinates for d2v7qj_:

Click to download the PDB-style file with coordinates for d2v7qj_.
(The format of our PDB-style files is described here.)

Timeline for d2v7qj_: