Lineage for d2v7qi1 (2v7q I:1-47)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778337Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 778465Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
  5. 778466Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (1 protein)
  6. 778467Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (1 species)
  7. 778468Species Cow (Bos taurus) [TaxId:9913] [48693] (3 PDB entries)
  8. 778469Domain d2v7qi1: 2v7q I:1-47 [152735]
    Other proteins in same PDB: d2v7qg1, d2v7qh1, d2v7qh2, d2v7qj1
    automatically matched to d1e79i_
    complexed with adp, atp, mg, po4

Details for d2v7qi1

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (I:) ATP synthase epsilon chain

SCOP Domain Sequences for d2v7qi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qi1 a.137.8.1 (I:1-47) Epsilon subunit of mitochondrial F1F0-ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
vaywrqaglsyirysqicakavrdalktefkanamktsgstikivkv

SCOP Domain Coordinates for d2v7qi1:

Click to download the PDB-style file with coordinates for d2v7qi1.
(The format of our PDB-style files is described here.)

Timeline for d2v7qi1: