| Class b: All beta proteins [48724] (177 folds) |
| Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily) pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns |
Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) ![]() |
| Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins) |
| Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species) delta subunit in mitochondria |
| Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries) |
| Domain d2v7qh2: 2v7q H:15-100 [152734] Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd1, d2v7qd2, d2v7qd3, d2v7qe1, d2v7qe2, d2v7qe3, d2v7qf1, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qi_, d2v7qj_ automated match to d1e79h2 complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7qh2 b.93.1.1 (H:15-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtl
Timeline for d2v7qh2: