Lineage for d2v7qh2 (2v7q H:15-101)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811784Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 811785Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 811786Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (1 protein)
  6. 811787Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (2 species)
    delta subunit in mitochondria
  7. 811788Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 811791Domain d2v7qh2: 2v7q H:15-101 [152734]
    Other proteins in same PDB: d2v7qg1, d2v7qh1, d2v7qi1, d2v7qj1
    automatically matched to d1h8eh_
    complexed with adp, atp, mg, po4

Details for d2v7qh2

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (H:) ATP synthase delta chain

SCOP Domain Sequences for d2v7qh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qh2 b.93.1.1 (H:15-101) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtld

SCOP Domain Coordinates for d2v7qh2:

Click to download the PDB-style file with coordinates for d2v7qh2.
(The format of our PDB-style files is described here.)

Timeline for d2v7qh2: