Lineage for d2v7ne2 (2v7n E:149-253)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786045Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 786046Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)
  8. 786049Domain d2v7ne2: 2v7n E:149-253 [152729]
    Other proteins in same PDB: d2v7na1, d2v7nc1, d2v7ne1, d2v7ng1
    automatically matched to d1rhha2

Details for d2v7ne2

PDB Entry: 2v7n (more details), 1.92 Å

PDB Description: unusual twinning in crystals of the cits binding antibody fab fragment f3p4
PDB Compounds: (E:) immunoglobulin light chain

SCOP Domain Sequences for d2v7ne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7ne2 b.1.1.2 (E:149-253) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d2v7ne2:

Click to download the PDB-style file with coordinates for d2v7ne2.
(The format of our PDB-style files is described here.)

Timeline for d2v7ne2: