Lineage for d2v7ne1 (2v7n E:1-148)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741608Species Synthetic construct [TaxId:32630] [158859] (2 PDB entries)
  8. 2741612Domain d2v7ne1: 2v7n E:1-148 [152728]
    Other proteins in same PDB: d2v7na2, d2v7nc2, d2v7ne2, d2v7ng2
    automatically matched to d1rhha1

Details for d2v7ne1

PDB Entry: 2v7n (more details), 1.92 Å

PDB Description: unusual twinning in crystals of the cits binding antibody fab fragment f3p4
PDB Compounds: (E:) immunoglobulin light chain

SCOPe Domain Sequences for d2v7ne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7ne1 b.1.1.1 (E:1-148) Immunoglobulin light chain kappa variable domain, VL-kappa {Synthetic construct [TaxId: 32630]}
divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik

SCOPe Domain Coordinates for d2v7ne1:

Click to download the PDB-style file with coordinates for d2v7ne1.
(The format of our PDB-style files is described here.)

Timeline for d2v7ne1: