![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
![]() | Species Synthetic construct [TaxId:32630] [158871] (1 PDB entry) |
![]() | Domain d2v7na2: 2v7n A:149-253 [152725] Other proteins in same PDB: d2v7na1, d2v7nc1, d2v7ne1, d2v7ng1 automatically matched to d1rhha2 |
PDB Entry: 2v7n (more details), 1.92 Å
SCOPe Domain Sequences for d2v7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7na2 b.1.1.2 (A:149-253) Immunoglobulin light chain kappa constant domain, CL-kappa {Synthetic construct [TaxId: 32630]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d2v7na2: