SCOP 1.75: Domain d2v7na1: 2v7n A:1-148

Lineage for d2v7na1 (2v7n A:1-148)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Escherichia coli [TaxId:562] [158860] (3 PDB entries)

8. Domain d2v7na1: 2v7n A:1-148 [152724]
   Other proteins in same PDB: d2v7na2, d2v7nc2, d2v7ne2, d2v7ng2
   automatically matched to d1rhha1

Details for d2v7na1

PDB Entry: 2v7n, 1.92 Å

PDB Description: unusual twinning in crystals of the cits binding antibody fab fragment f3p4

PDB Compounds: (A:) immunoglobulin light chain

SCOP Domain Sequences for d2v7na1:

Sequence; same for both SEQRES and ATOM records:

>d2v7na1 b.1.1.1 (A:1-148) Immunoglobulin light chain kappa variable domain, VL-kappa {Escherichia coli [TaxId: 562]}
divltqspatlslspgeratlscrasqsvssnylawyqqkpgqaprlliydsssratgvp
arfsgsgsgtdftltisslepedfavyychqysdisptfgqgtkveik

Timeline for d2v7na1:

• d2v7na1 is new in SCOP 1.75
  
• d2v7na1 appears in SCOPe 2.01
  
• d2v7na1 appears in the current release, SCOPe 2.08