SCOPe 2.06: Domain d2v7fa1: 2v7f A:2-150

Lineage for d2v7fa1 (2v7f A:2-150)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.84: Rps19E-like [158338] (1 protein)
   Pfam PF01090; local sequence similarity to members of the GntR-like family

6. Protein Ribosomal protein S19e [158339] (1 species)

7. Species Pyrococcus abyssi [TaxId:29292] [158340] (1 PDB entry)
   Uniprot Q9V0G8 2-150

8. Domain d2v7fa1: 2v7f A:2-150 [152721]
   complexed with cl

Details for d2v7fa1

PDB Entry: 2v7f, 1.15 Å

PDB Description: structure of p. abyssi rps19 protein

PDB Compounds: (A:) rps19e ssu ribosomal protein s19e

SCOPe Domain Sequences for d2v7fa1:

Sequence, based on SEQRES records:

>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]}
atvydvpgdllvervaqrlkeipeikppewapfvktgrhkerlpeqedwwyyrvasilrr
vyldgpvgierlrtyyggrknrghaperfykaggsiirkalqqleaagfvekvpgkgrvi
tpkgrsfldkiatelkkeleeiipelkky

Sequence, based on observed residues (ATOM records):

>d2v7fa1 a.4.5.84 (A:2-150) Ribosomal protein S19e {Pyrococcus abyssi [TaxId: 29292]}
atvydvpgdllvervaqrlkeipeikppewapfvktlpeqedwwyyrvasilrrvyldgp
vgierlrtyyggghaperfykaggsiirkalqqleaagfvekvpgkgrvitpkgrsfldk
iatelkkeleeiipelkky

Timeline for d2v7fa1:

• d2v7fa1 first appeared in SCOP 1.75
  
• d2v7fa1 appears in SCOPe 2.05
  
• d2v7fa1 appears in SCOPe 2.07
  
• d2v7fa1 appears in the current release, SCOPe 2.08